PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre05.g242600.t1.2
Common NameCHLREDRAFT_187360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 398aa    MW: 40277.1 Da    PI: 6.6774
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre05.g242600.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.71.2e-16317351135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +Cg+t++p+WRrgp  +++LCnaCG +yr++++
  Cre05.g242600.t1.2 317 CDHCGATESPQWRRGPPAKPMLCNACGTRYRRTNQ 351
                         9***************99999**********9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577167.6E-12311358No hitNo description
SMARTSM004015.7E-10311368IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.347311355IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.1E-12312355IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.82E-12316355No hitNo description
PfamPF003206.3E-14317351IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MAPAPAFEPS CSMLSVFSMC TALPLAERDV NGAGACFSGA SALACPSKPA SIRRGASFLD  60
VEDACVGLTS ADRACFLIPE DSVYVSPACS ARENAGAGPR LPLPSGTFTT AVATSTSGAS  120
LSGLSAAPTG FLAGCEEFVH ASVCFEKAAQ ALEAVTRPPP AVPSCSPSTS SGAANGAQAD  180
EPAAGLFRRV SSLAPSPAAS SHENHQHQHQ DGSCCSSAEA VEAPAAPVVS DGAAACAEQL  240
PQQVLLPQVP LEHHRHEYLD ASSAALQLQA QLPTMLEEQQ QQSPEEAAQP EQLQLLQAVP  300
APAPAPRAFH HKTGGPCDHC GATESPQWRR GPPAKPMLCN ACGTRYRRTN QLGPVGAHTP  360
AGRAAAAAAA AGASVSGGKR ISKGHGGAAA KRNRASY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.150870.0normal conditions
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre05.g242600.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001700906.10.0predicted protein
TrEMBLA8I5570.0A8I557_CHLRE; Predicted protein
STRINGEDP071600.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.12e-12GATA transcription factor 26
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]